PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GATA
Protein Properties Length: 423aa    MW: 47598.4 Da    PI: 8.1589
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25721genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.82.6e-17345379135
      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
               C++C + +Tp+WR+gp g+ktLCnaCG++y++ +l
  EMT25721 345 CTHCLSHTTPQWRSGPLGPKTLCNACGVRYKSGRL 379
               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.0E-4226279IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-4231265IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS501148.629235264IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.543339375IPR000679Zinc finger, GATA-type
SMARTSM004013.6E-16339393IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-14343403No hitNo description
Gene3DG3DSA:3.30.50.103.4E-13344377IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.12E-13344391No hitNo description
PfamPF003203.6E-15345379IPR000679Zinc finger, GATA-type
PROSITE patternPS003440345370IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MDRNVQGAEG SWAAAGPGVE GRRQQVGTDT RYGAVEVQRG LGGGVGGIGE GVGGIATTPA  60
SDYADRKQGR RDAVRKKALR MGFLWGLRVS GRLRGGCPDV CRPSPDLLLE SEDSSTEWLS  120
IYLEDCLTNP SSYPVSEEQA SVNPNLPHPS SSNPRRKKRS LASVIRDSDE EYFLIVEPPL  180
LLDQKHWLAE SELILPKKDK DQELVQKLEQ EHEEEYKPYT VQFKQEQAVM RCSVCLSNSN  240
QTPQQWQGGP SGALLCNTCS LRLKAGNGFI KLERCGQQVD EEQDHGRGQD KRKIKKTTYY  300
GDDEEPPQEK RRIKKTSFVD EQGKRRTKKT YVNEEVPLEE PVKRCTHCLS HTTPQWRSGP  360
LGPKTLCNAC GVRYKSGRLL PEYRPANSPT FVSFMHSNSH KKVMQMRKSV ENEHEHEYSH  420
SDM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2562810.0AC256281.1 Hordeum vulgare clone HV_Mba475-H03, complete sequence.
GenBankAK2517110.0AK251711.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf124o21, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579113.11e-120PREDICTED: GATA transcription factor 2-like
TrEMBLM8CQ440.0M8CQ44_AEGTA; GATA transcription factor 4
STRINGBRADI4G01140.11e-119(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-34GATA transcription factor 4